PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_02778A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 275aa    MW: 31394.9 Da    PI: 6.0488
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_02778AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.81.4e-191663148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT++Ed+ll+++v+q+G g+W+++a+  g++R++k+c++rw +yl
  Oropetium_20150105_02778A 16 KGPWTAQEDKLLLEYVRQHGEGRWNSVAKLTGLKRSGKSCRLRWVNYL 63
                               79********************************************97 PP

2Myb_DNA-binding513.3e-1669113147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                rg+ T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
  Oropetium_20150105_02778A  69 RGKITPQEESVILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 113
                                8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5581163IPR017930Myb domain
SuperFamilySSF466891.8E-3014110IPR009057Homeodomain-like
SMARTSM007173.6E-171565IPR001005SANT/Myb domain
PfamPF002491.0E-181663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-241770IPR009057Homeodomain-like
CDDcd001677.38E-121863No hitNo description
PROSITE profilePS5129424.93364118IPR017930Myb domain
SMARTSM007174.5E-1568116IPR001005SANT/Myb domain
PfamPF002495.8E-1469113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-2471116IPR009057Homeodomain-like
CDDcd001673.95E-973114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MEGQFGWGRE EGGWRKGPWT AQEDKLLLEY VRQHGEGRWN SVAKLTGLKR SGKSCRLRWV  60
NYLRPDLKRG KITPQEESVI LELHALWGNR WSTIARSLPG RTDNEIKNYW RTHFKKGKPS  120
KNIERARARF LKQRREMQSQ LLLQGQDQQQ HQELEQPDHD AATAVREEVP AAASPAQQHE  180
DLHMMQDMDD LLYQLCPMSA MMSSSCSSYL LHGGRASAAS EGSSEDHLDD GGGDTWGWGS  240
LWNLDVVDDV DDGARGWDWD NSCPWLQDQG LTFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26161167106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0992831e-143AK099283.1 Oryza sativa Japonica Group cDNA clone:J023132O17, full insert sequence.
GenBankAK1118071e-143AK111807.1 Oryza sativa Japonica Group cDNA clone:J013104N22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002454181.11e-130hypothetical protein SORBIDRAFT_04g026210
TrEMBLC5XXQ51e-130C5XXQ5_SORBI; Putative uncharacterized protein Sb04g026210
STRINGSb04g026210.11e-129(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.17e-65myb domain protein 79